ZP4 Blocking Peptide (33R-6616)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZP4 antibody, catalog no. 70R-7191

Synonyms ZP4 control peptide, ZP4 antibody Blocking Peptide, Anti-ZP4 Blocking Peptide, Zona Pellucida Glycoprotein 4 Blocking Peptide, ZBP Blocking Peptide, ZP1 Blocking Peptide, ZPB Blocking Peptide, ZP4, ZP-4, ZP 4, ZP-4 Blocking Peptide, ZP 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT
Molecular Weight 49 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors