ZP4 Blocking Peptide (33R-6616)
A synthetic peptide for use as a blocking control in assays to test for specificity of ZP4 antibody, catalog no. 70R-7191
Overview
Overview
| Synonyms | ZP4 control peptide, ZP4 antibody Blocking Peptide, Anti-ZP4 Blocking Peptide, Zona Pellucida Glycoprotein 4 Blocking Peptide, ZBP Blocking Peptide, ZP1 Blocking Peptide, ZPB Blocking Peptide, ZP4, ZP-4, ZP 4, ZP-4 Blocking Peptide, ZP 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT |
|---|---|
| Molecular Weight | 49 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product