ZPBP2 Blocking Peptide (33R-6236)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZPBP2 antibody, catalog no. 70R-9229

Synonyms ZPBP2 control peptide, ZPBP2 antibody Blocking Peptide, Anti-ZPBP2 Blocking Peptide, zona pellucida binding protein 2 Blocking Peptide, MGC41930 Blocking Peptide, ZPBPL Blocking Peptide, ZPBP2, ZPBP-2, ZPBP 2, ZPBP-2 Blocking Peptide, ZPBP 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MMRTCVLLSAVLWCLTGVQCPRFTLFNKKGFIYGKTGQPDKIYVELHQNS
Molecular Weight 39 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZPBP2 may be implicated in gamete interaction during fertilization.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors