ZPBP2 Blocking Peptide (33R-6236)
A synthetic peptide for use as a blocking control in assays to test for specificity of ZPBP2 antibody, catalog no. 70R-9229
Overview
Overview
| Synonyms | ZPBP2 control peptide, ZPBP2 antibody Blocking Peptide, Anti-ZPBP2 Blocking Peptide, zona pellucida binding protein 2 Blocking Peptide, MGC41930 Blocking Peptide, ZPBPL Blocking Peptide, ZPBP2, ZPBP-2, ZPBP 2, ZPBP-2 Blocking Peptide, ZPBP 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MMRTCVLLSAVLWCLTGVQCPRFTLFNKKGFIYGKTGQPDKIYVELHQNS |
|---|---|
| Molecular Weight | 39 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ZPBP2 may be implicated in gamete interaction during fertilization. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product